SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004345 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004345
Domain Number 1 Region: 797-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000165
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 428-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000026
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 835-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000299
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004345   Gene: ENSMMUG00000003261   Transcript: ENSMMUT00000004611
Sequence length 894
Comment pep:novel chromosome:MMUL_1:7:162432724:162531685:-1 gene:ENSMMUG00000003261 transcript:ENSMMUT00000004611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQ
CQMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVT
PDEDDHLLSPTKGICPKQENIAGPCRPAQLPAVAPIAASSHPHSSVITSPLRALGALPPC
LPLPCCSARPVSGDGTQGEGQTEAPFGCQCQLSGKDEPSSYICTTCKQPFNSAWFLLQHA
QNTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLMNFLGDSNPFNLLRMTGPILR
DHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPA
MDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPPGGTPPP
QPPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHK
AGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEE
EEELLLENESRPESSFSMDSELSRNRENGGGGVAGVPGAGGGAAKALADEKALVLGKVME
NVGLGALPQYGELLADKQKRGAFLKRAAGGGDAGDDDDAGGCGDTGAGGAVNGRGGGFAP
GTEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAALIPSENVYSQWLVGYAASRH
FMKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLG
GPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLT
RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS
Download sequence
Identical sequences A0A2K5NJ79 A0A2K6D8Y7
ENSMMUP00000004345 ENSMMUP00000004345 XP_001103061.1.72884 XP_011715342.1.29376 XP_011939299.1.92194 9544.ENSMMUP00000004345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]