SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004361 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004361
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.49e-42
Family N-terminal domain of cbl (N-cbl) 0.00031
Further Details:      
 
Domain Number 2 Region: 281-358
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-39
Family RING finger domain, C3HC4 0.00015
Further Details:      
 
Domain Number 3 Region: 149-233
Classification Level Classification E-value
Superfamily EF-hand 1.04e-38
Family EF-hand modules in multidomain proteins 0.00015
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000895
Family SH2 domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004361   Gene: ENSMMUG00000003271   Transcript: ENSMMUT00000004627
Sequence length 428
Comment pep:known chromosome:MMUL_1:19:51211824:51234995:1 gene:ENSMMUG00000003271 transcript:ENSMMUT00000004627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVAPWGRQWEEARALGRAVRMLQRLEEQCSDPRLSLSPPSLRDLLPRTAQLLREVAS
AQRAAGRGGPGGPGGSRDFLLVYLANLEAKSRQLGALLPPRGRRSANDELFRAGSSLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHVYQLTKAPAHIFWREHCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYLYPDGKNHNPDLTELDQAEAQQRIHVSEEQLQLYWAMDS
TFELCKICAESNKDVKIEPCGHLLCSRCLAAWQHSDSQTCPFCRCKIKGWEAVSIYEFHG
QATAEDSEDGSDQEGRELELEQAPVLAPQLPPRPDLPPRKPRNAQPKVRLLKGSSPPAAL
GPQDPAPA
Download sequence
Identical sequences ENSMMUP00000004361 XP_014979724.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]