SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004380 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004380
Domain Number 1 Region: 109-356
Classification Level Classification E-value
Superfamily vWA-like 4.22e-86
Family Integrin A (or I) domain 0.000000000301
Further Details:      
 
Domain Number 2 Region: 352-442
Classification Level Classification E-value
Superfamily Integrin domains 1.57e-33
Family Integrin domains 0.0000031
Further Details:      
 
Domain Number 3 Region: 608-692
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.76e-24
Family Integrin beta tail domain 0.0000037
Further Details:      
 
Domain Number 4 Region: 5-59
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000942
Family Plexin repeat 0.0000277
Further Details:      
 
Domain Number 5 Region: 566-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 524-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000273
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004380
Domain Number - Region: 492-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004380   Gene: ENSMMUG00000003289   Transcript: ENSMMUT00000004646
Sequence length 764
Comment pep:known chromosome:MMUL_1:16:57350154:57385707:1 gene:ENSMMUG00000003289 transcript:ENSMMUT00000004646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPV
SEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLM
DLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCY
DMKTTCLPMFGYKHVLSLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGW
RNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEK
LSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELE
VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKP
VGFKDSLIVQVTFDCDCACQAQAEPNSRHCNNGNGTFECGVCRCGPGWLGSQCECSEEDY
RPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSG
HGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTC
EKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYK
NEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLATLLIWKLL
ITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Download sequence
Identical sequences ENSMMUP00000004380 9544.ENSMMUP00000004380 ENSMMUP00000004380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]