SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004406 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004406
Domain Number 1 Region: 625-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-80
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 53-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-66
Family Ephrin receptor ligand binding domain 0.000000605
Further Details:      
 
Domain Number 3 Region: 337-542
Classification Level Classification E-value
Superfamily Fibronectin type III 5.11e-40
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 921-994
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.35e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004406
Domain Number - Region: 264-335,388-393
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000903
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004406   Gene: ENSMMUG00000003304   Transcript: ENSMMUT00000004672
Sequence length 997
Comment pep:known chromosome:MMUL_1:2:102068996:102088248:-1 gene:ENSMMUG00000003304 transcript:ENSMMUT00000004672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARTPPPPPLSPPPGLLPLLPPLLLLPLLLPAGCRALEGERPAATWLLSMALWKPERG
WEEVSGYDEAMNPIRTYQVCNVHESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPN
IPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSF
GPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGTC
IPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPC
LPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSE
PRDLGGRDDLLYNVICKKCHGVGGASVCSRCDDNVEFVPRQLGLTERRVHISHLLAHTRY
TFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNG
VILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFE
TTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYI
APGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVF
VAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDS
FLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSR
FLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWD
MSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAAS
LKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMT
AEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences ENSMMUP00000004406 9544.ENSMMUP00000004406 ENSMMUP00000004406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]