SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004476 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004476
Domain Number 1 Region: 1334-1557
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.22e-80
Family Fibrinogen C-terminal domain-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 4.22e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 1164-1328
Classification Level Classification E-value
Superfamily Fibronectin type III 3e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 4 Region: 1071-1160
Classification Level Classification E-value
Superfamily Fibronectin type III 1.3e-19
Family Fibronectin type III 0.0000185
Further Details:      
 
Domain Number 5 Region: 624-786
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 801-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000525
Family Fibronectin type III 0.000003
Further Details:      
 
Domain Number 7 Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000652
Family Integrin beta EGF-like domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004476
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000368
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000652
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000978
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00182
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00247
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00284
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00312
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00512
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00559
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00605
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00791
Family EGF-type module 0.07
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00884
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0135
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004476   Gene: ENSMMUG00000003356   Transcript: ENSMMUT00000004748
Sequence length 1564
Comment pep:known_by_projection chromosome:MMUL_1:15:20995365:21065626:1 gene:ENSMMUG00000003356 transcript:ENSMMUT00000004748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMTRLSAVVLLALLALLTEGGVLKKVIRHKRQSGVNITLPEENQPVVFNHVYNTKLPV
GSQCSVDLESPSGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCAAGAGCCLQSAIGRVDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCNLRGQCIDGQCICDEGFTGEDCSQLACPGDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHEGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHGQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGQCECDDGFTGADCGELKCPSGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVQGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGRCVDGQCVCEDGFTGPDCAELSCPNDCHGRG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCMDGQCICHEGFTGLDCGQRSCPSDCSN
LGQCVSGRCICNEGYAGEDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQMEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHTEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLRVSETAETSLTLFWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTAMGSPKEVI
FSDITENSATVSWRAPTAQVESFRITYVPITGGTPSMVTVDGTKTQTRLVKLVPGVEYLV
NIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEK
VPEITRMVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTVTAKFTTDLDSPRDLTATE
VQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLVDLSPSSHYTAKIQA
LNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMT
SDGGGWIVFLRRKNGHENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLR
DHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCA
LSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGR
RKRA
Download sequence
Identical sequences ENSMMUP00000004476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]