SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004520 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004520
Domain Number 1 Region: 20-95
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000392
Family Myosin rod fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004520   Gene: ENSMMUG00000003386   Transcript: ENSMMUT00000004794
Sequence length 105
Comment pep:known_by_projection chromosome:MMUL_1:12:101629796:101647801:1 gene:ENSMMUG00000003386 transcript:ENSMMUT00000004794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELK
AEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
Download sequence
Identical sequences Q9BSL6
ENSMMUP00000004520 10947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]