SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004788 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004788
Domain Number 1 Region: 74-341
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.03e-57
Family beta 1,4 galactosyltransferase (b4GalT1) 0.000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004788   Gene: ENSMMUG00000003592   Transcript: ENSMMUT00000005081
Sequence length 344
Comment pep:known chromosome:MMUL_1:2:39235582:39260980:-1 gene:ENSMMUG00000003592 transcript:ENSMMUT00000005081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFNLTFHLSYKLRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKELVANFHKALILGKG
KTLTNEASTQKAELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKA
LQRVAILIPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE
ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELHRMKISRPLPEVGKYTMVFHTRDKGNEVNAE
RMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYVNITVDFWSGA
Download sequence
Identical sequences F7HPG1 G7NXN3
ENSMMUP00000004788 ENSMMUP00000039967 9544.ENSMMUP00000004788 ENSMMUP00000004788 NP_001244761.1.72884 XP_005548130.1.63531 XP_005548131.1.63531 XP_014985385.1.72884 XP_014985386.1.72884 XP_015301878.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]