SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004820 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004820
Domain Number 1 Region: 186-342,432-693
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.88e-62
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 795-915
Classification Level Classification E-value
Superfamily PKD domain 2.88e-18
Family PKD domain 0.00025
Further Details:      
 
Domain Number 3 Region: 929-997
Classification Level Classification E-value
Superfamily PKD domain 0.0000122
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004820   Gene: ENSMMUG00000003610   Transcript: ENSMMUT00000005116
Sequence length 1222
Comment pep:known chromosome:MMUL_1:9:104346506:104955784:1 gene:ENSMMUG00000003610 transcript:ENSMMUT00000005116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARTERPAGWPGAPLVRTGLLLLSTWVLAGAEITWDATGGPGRPAAPASWPPALSPLS
SRAVASQWPEELAKARRAAVLGRRAGPELLPQQGGGRSGEMQVEAGGTSPAGERRDRGIP
APGKLGGARRSRRAQPPSTPERGDARATAPADGSRGSRPLAKGSREEVKAPRAGGSAAED
LRLPSTSFALTGDSAHNQAMVHWSGHNSSVILILTKLYDFNLGSVTESSLWRSTDYGTTY
EKLNDKVGLKTVLSYLYVNPTNKRKIMLLSDPEIESSILISSDEGATYQKYRLTFYIQSL
LFHPKQEDWVLAYSLDQKLYSSMDFGRRWQLMHERITPNRFYWSVAGLDKEADLVHMEVR
TTDGYAHYLTCRIQECAETTRNGPFARSIDISSLVVQDEYIFIQVTTGGRASYYVSYRRE
AFAQIKLPKYSLPKDMHIISTDENQVFAAVQEWNQNDTYNLYISDTRGIYFTLAMENIKS
SRGLMGNIIIELYEVAGIKGIFLANKKVDDQVKTYITYNKGRDWRLLQAPDVDLRGSPVH
CLLPFCSLHLHLQLSENPYSSGRISSKETAPGLVVATGNIGPELSYTDIGVFISSDGGNT
WRQIFDEEYNVWFLDWGGALVAMKHTPLPVRHLWVSFDEGHSWDKYGFTSVPLFVDGALV
EAGMETHIMTVFGHFSLRSEWQLVKVDYKSIFSRHCTKEDYQTWHLLNQGEPCVMGERKI
FKKRKPGAQCALGRDHSGSVVSEPCVCANWDFECDYGYERHGESQCVPAFWYNPASPSKD
CSLGQSYLNSTGYRRIVSNNCTDGLREKYTAKAQMCPGKAPRGLHVVTTDGRLVAEQGHN
ATFIILMEEGDLQRTNIQLDFGDGIAVSYANFSPIEDGIKHVYKSAGIFQVTAYAENNLG
SDTAVLFLHVVCPVEHVHLRVPFVAIRNKEVNISAVVWPSQLGTLTYFWWFGNSTKPLIT
LDSSISFTFVAEGTNTITVQVAAGNALIQDTKEIAVHEYFQSQLLSFSPNLDYHNPDIPE
WRQDIGNVIKRALVKVTSVPEDQILIAVFPGLPTSAELFILPPKNLTERRKGNEGDLEQI
VETLFNALNQNLVQFELKPGVQVIVYVTQLTLAPLVDSSAGHSSSAMLMLLSVVFVGLAV
FLIYKFKRKIPWINIYAQVQHDKEQEMIGSVSQSENAPKITLSDFTEPEELLDKELDTRV
IGGIATIANSESTKEIPNCTSV
Download sequence
Identical sequences F6QFA6
9544.ENSMMUP00000004820 ENSMMUP00000035662 XP_015003597.1.72884 ENSMMUP00000004820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]