SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004959 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004959
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily L domain-like 1.79e-38
Family L domain 0.000000615
Further Details:      
 
Domain Number 2 Region: 121-244
Classification Level Classification E-value
Superfamily Fibronectin type III 9.19e-34
Family Fibronectin type III 0.000000141
Further Details:      
 
Domain Number 3 Region: 636-786
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.99e-33
Family Protein kinases, catalytic subunit 0.0000000866
Further Details:      
 
Domain Number 4 Region: 428-570
Classification Level Classification E-value
Superfamily Fibronectin type III 2.03e-24
Family Fibronectin type III 0.00000225
Further Details:      
 
Domain Number 5 Region: 248-328,434-458
Classification Level Classification E-value
Superfamily Fibronectin type III 7.85e-20
Family Fibronectin type III 0.000000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004959   Gene: ENSMMUG00000028907   Transcript: ENSMMUT00000005264
Sequence length 786
Comment pep:known chromosome:MMUL_1:19:6987691:7037130:-1 gene:ENSMMUG00000028907 transcript:ENSMMUT00000005264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQN
LRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQAS
CENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSN
SWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIY
VQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYC
LKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFED
YLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSTPTSPEE
HRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIV
GPVTHEIFENNIVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLR
GLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSIVIGS
IYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSF
GMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVS
KGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKK
FVHRDL
Download sequence
Identical sequences 9544.ENSMMUP00000004959 ENSMMUP00000004959 ENSMMUP00000031912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]