SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004967 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004967
Domain Number 1 Region: 753-918
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-34
Family MAM domain 0.00068
Further Details:      
 
Domain Number 2 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 5.92e-17
Family I set domains 0.0051
Further Details:      
 
Domain Number 3 Region: 343-444
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000446
Family I set domains 0.043
Further Details:      
 
Domain Number 4 Region: 48-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000117
Family I set domains 0.069
Further Details:      
 
Domain Number 5 Region: 438-542
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000156
Family I set domains 0.036
Further Details:      
 
Domain Number 6 Region: 540-634
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000805
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 131-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000811
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 194-240,635-743
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000649
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004967   Gene: ENSMMUG00000003725   Transcript: ENSMMUT00000005273
Sequence length 957
Comment pep:known chromosome:MMUL_1:4:37418384:37476888:-1 gene:ENSMMUG00000003725 transcript:ENSMMUT00000005273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQC
LVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIK
SIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPP
ALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQA
RDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVD
AVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFP
GAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDK
EAALMPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQLNVQCEPV
PPEVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDH
AELRLDAVTRDSSGSYECSVSNDVGSAVCLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYS
YVLQWTQREPDAVDPVLNYRLSVRQLNQHNAVVKAIPVRRVEKGQLLEYILTDLRVPHSY
EVRLTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQN
ALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFF
YHMYGKHIGELGDQVVSTKCALTSRGWALERLTGGTHPGFHRAQAPVGNFQIIFEGVRGS
GYLGDIAIDDVTLKKGECPRKQMDPNKVVVMPGSGAPCQSSPQLWGPMAIFLLALQR
Download sequence
Identical sequences ENSMMUP00000004967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]