SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004986 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004986
Domain Number 1 Region: 41-252
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-83
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000171
Further Details:      
 
Domain Number 2 Region: 542-760
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.78e-59
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 3 Region: 248-380
Classification Level Classification E-value
Superfamily E set domains 3.27e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000112
Further Details:      
 
Domain Number 4 Region: 808-889
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-16
Family DEATH domain, DD 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004986
Domain Number - Region: 874-922
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0102
Family DNA polymerase beta, N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004986   Gene: ENSMMUG00000003736   Transcript: ENSMMUT00000005292
Sequence length 968
Comment pep:known chromosome:MMUL_1:5:95474025:95596388:1 gene:ENSMMUG00000003736 transcript:ENSMMUT00000005292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDSEGCDRSDDRNTVNLFGKVIETTEHNQEPSEATDGNGE
VTLTYATRAKEESARVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAA
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGGSLLTLNKMPHDYGQ
EGPLEGKI
Download sequence
Identical sequences A0A2K5TPZ9 A0A2K6BHS1 F7HKH9
ENSMMUP00000004986 XP_011747491.1.29376 XP_011847646.1.47321 XP_014994321.1.72884 XP_015306180.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]