SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005072 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005072
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0028
Further Details:      
 
Domain Number 2 Region: 30-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000000209
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005072   Gene: ENSMMUG00000003806   Transcript: ENSMMUT00000005385
Sequence length 133
Comment pep:known chromosome:MMUL_1:10:18904634:18910197:1 gene:ENSMMUG00000003806 transcript:ENSMMUT00000005385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLLSLLVLFILLVNVQGPGLTDWLFPRRCPTIREECEFRERDVCTRHRQCPDNKKC
CVFSCGKKCLDLKQDVCEMPNETGPCLAFFIRWWYDKKNNTCSTFVYGGCQGNNNNFQSE
ANCLNTCKNKRFP
Download sequence
Identical sequences ENSMMUP00000005072 ENSMMUP00000005074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]