SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005078 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005078
Domain Number 1 Region: 107-136
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000284
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.011
Further Details:      
 
Domain Number 2 Region: 32-71
Classification Level Classification E-value
Superfamily Elafin-like 0.0000183
Family Elafin-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005078   Gene: ENSMMUG00000003809   Transcript: ENSMMUT00000005391
Sequence length 138
Comment pep:known_by_projection chromosome:MMUL_1:10:18902667:18916134:1 gene:ENSMMUG00000003809 transcript:ENSMMUT00000005391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSGLLPILVPFILLGDIQEPGHAEGIFGKLCPKIKVECEVEEIDHCTKHRDCPENMKL
CLFSCGKKCLDLRQEVYAVCHRRLAPAWPPYHVGGTIKKQNKTKRKTICSEFIYGRCQGN
NNNFQTEAICLVTCKKYH
Download sequence
Identical sequences ENSMMUP00000005078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]