SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005188 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005188
Domain Number 1 Region: 56-130
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000994
Family Multidrug resistance efflux transporter EmrE 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005188   Gene: ENSMMUG00000003892   Transcript: ENSMMUT00000005512
Sequence length 360
Comment pep:known chromosome:MMUL_1:7:1785319:1819369:-1 gene:ENSMMUG00000003892 transcript:ENSMMUT00000005512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGRGKYDFYIGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWW
AGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSI
LGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFAVGPRHGQTNILV
YITICSVIGAFSVSCVKGLGIALKELFAGKPVLRHPLAWVLLLSLIVCVSTQINYLNRAL
DIFNTSIVTPIYYVFFTTSVLTCSAILFKEWQDMPGDDVIGTLSGFFTIIVGIFLLHAFK
DVSFSLASLPVSFRKDEKAVNGNLSNMYEVLNNNEESLTCGIEQHTGENVSRRNGNLTAF
Download sequence
Identical sequences A0A2K5LEL6 A0A2K6CIC9 F7DAX6 G7PAF6
9544.ENSMMUP00000034028 XP_001106204.1.72884 XP_005558970.1.63531 XP_005558971.1.63531 XP_011766805.1.29376 XP_011766806.1.29376 XP_011766807.1.29376 XP_011931046.1.92194 XP_011931047.1.92194 XP_014997164.1.72884 XP_015307997.1.63531 ENSMMUP00000005188 ENSMMUP00000005188 ENSMMUP00000034028 ENSMMUP00000034029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]