SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005204 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005204
Domain Number 1 Region: 724-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-104
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.57e-34
Family TSP type-3 repeat 0.00000396
Further Details:      
 
Domain Number 3 Region: 516-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.14e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000109
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 445-540
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000798
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 6 Region: 53-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000135
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 7 Region: 316-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005204
Domain Number - Region: 363-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 278-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 416-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0718
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005204   Gene: ENSMMUG00000003902   Transcript: ENSMMUT00000005528
Sequence length 956
Comment pep:known chromosome:MMUL_1:1:133744956:133757840:-1 gene:ENSMMUG00000003902 transcript:ENSMMUT00000005528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCSFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECVHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHVHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDVDSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences A0A2K6ECM2 F6ZVD5 G8F669
ENSMMUP00000005204 9544.ENSMMUP00000005204 NP_001247443.1.72884 XP_011768018.1.29376 XP_015311696.1.63531 ENSMMUP00000005204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]