SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005371 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005371
Domain Number 1 Region: 117-227
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000003
Family Cadherin 0.004
Further Details:      
 
Domain Number 2 Region: 248-342
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000126
Family Cadherin 0.0038
Further Details:      
 
Domain Number 3 Region: 58-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000514
Family Cadherin 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005371
Domain Number - Region: 351-449
Classification Level Classification E-value
Superfamily Cadherin-like 0.00014
Family Cadherin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005371   Gene: ENSMMUG00000004024   Transcript: ENSMMUT00000005706
Sequence length 652
Comment pep:known_by_projection chromosome:MMUL_1:14:426626:434422:-1 gene:ENSMMUG00000004024 transcript:ENSMMUT00000005706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSWALLWPPLLLTGLLGRPPGTVAQVQYCSVNKSFFEVEENTNVTEPLVDIHVPEGQEV
TLGPLSTPFAFRIQGNQLFLNVSPDYEENSLLEAQLLCQSGGTPVTQLRVFVSVLDVNDN
APEFPFTTKEIRVEEDTKVNSTVIPETELQAKDKDKDDILFYTLQEATAGASDYFSLVGV
NHPALRLDRPLDFYERPNMAFRLLVRDTPEENVEPSHTATATLVLNVVPADLRPPWFLPC
TFSDGYVCIQAQYHGAVPTGHTLPSPLVLHPGPIYAEDGDRGINQAIIYSIFSGNVNGTF
VIHRDSGNLTMARSVPRAMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQSLYR
GTVALGAGAGVVVKDAAAPSQPLRVQARDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT
TLTQAGAFYAEVEAKNTVTSGTATTVIEIQVSEQEPPSTGGGPSEDKRFSVVDMAALGGV
LGALLLLALLGLTVLVHKHYGSRLKCCSGKAPEPQPSGYDNQAFLPDDEANWAPAPSPTS
DAKPAEAPPTPAEPAPPGPAPPGSAPEAPAAAVAGGSPAAVRSILTKERRPEGGYKAVWF
GEDIGAEADVVVLNTPTLDVDGASDSGSGDEGEGAGPGRGSHDEPGGDDSYI
Download sequence
Identical sequences F6XG52
ENSMMUP00000005371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]