SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005446 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005446
Domain Number 1 Region: 323-430
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.88e-42
Family Transforming growth factor (TGF)-beta 0.000000771
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005446
Domain Number - Region: 156-210
Classification Level Classification E-value
Superfamily Bacillus cereus metalloprotein-like 0.0641
Family Bacillus cereus metalloprotein-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005446   Gene: ENSMMUG00000004074   Transcript: ENSMMUT00000005783
Sequence length 431
Comment pep:known chromosome:MMUL_1:10:7268684:7368069:1 gene:ENSMMUG00000004074 transcript:ENSMMUT00000005783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH
Download sequence
Identical sequences A0A096NNJ3 A0A0D9RSE9 A0A2J8TXL6 A0A2K5J3N7 A0A2K5KKN9 A0A2K5V0V5 A8K571 G7N4G7 H2QKM7 P18075
ENSPANP00000014553 NP_001710.1.87134 NP_001710.1.92137 XP_001089245.1.72884 XP_001170064.1.37143 XP_003806206.1.60992 XP_005569471.1.63531 XP_008011576.1.81039 XP_011792084.1.43180 XP_011914323.1.92194 9544.ENSMMUP00000005446 9598.ENSPTRP00000023489 9606.ENSP00000379204 ENSMMUP00000005446 ENSMMUP00000005446 ENSPTRP00000023489 gi|4502427|ref|NP_001710.1| ENSP00000379204 ENSP00000379204 399861 ENSPTRP00000023489 ENSP00000379204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]