SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005460 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005460
Domain Number 1 Region: 45-129
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005460   Gene: ENSMMUG00000004085   Transcript: ENSMMUT00000005798
Sequence length 180
Comment pep:known_by_projection chromosome:MMUL_1:19:52461272:52475402:-1 gene:ENSMMUG00000004085 transcript:ENSMMUT00000005798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQAKLI
VPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAI
VQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASPADVLPAAAAASAAAASGLLGPA
Download sequence
Identical sequences 9544.ENSMMUP00000005460 ENSMMUP00000005460 ENSMMUP00000005460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]