SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005486 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005486
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.7e-40
Family Laminin G-like module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005486
Domain Number - Region: 1453-1503
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00471
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005486   Gene: ENSMMUG00000004103   Transcript: ENSMMUT00000005825
Sequence length 1634
Comment pep:known_by_projection chromosome:MMUL_1:1:105876958:106068668:-1 gene:ENSMMUG00000004103 transcript:ENSMMUT00000005825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGPF
PEDFSILFTVKPKKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFR
TVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEV
FEGDIQQFLITGDPKAAYDYCEHYSPDCDSSAPKAAQAQEPQIDEQTNKQNPESLNKEQN
YEIPIKRNPISKEYKEYEDKPTRPPNEINGHGAYGEKGQKGEPAVVEPGMLVEGPPGPAG
PAGIMGPPGLQGPTGPPGDPGDRGPPGRPGLPGADGLPGPPGTMLMLPFRYGGDGSKGPT
ISAQEAQAQAILQQARIALRGPPGPMGLTGRPGPVGGPGSAGAKGESGGNIKPQGFENKG
PRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGSKGDRGFDGLPGLPGDKGHRGERGPQG
PPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMG
PQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKPGLAGLPGADGPPGHPGKEGQSG
EKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVG
QIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPG
ANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPKGTSGGDGPPGPPGERGPQG
PQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPGGVVGPQGPTGETGPIG
ERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGISGKDGPAGLRGFPGERGLPGAQGAPG
LKGGEGPQGPPGPVGSPGERGSAGTAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAG
RDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPG
IAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGLQGLPGPPGEKGENGDVGPMGPPG
PPGPRGPQGPNGADGPQGPPGSVGSVGGVGEKGEPGEAGNPGPPGEAGVGGPKGERGEKG
EAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGPPGEPGPAGQDGVGGDKGEDGDPG
QPGPPGPSGEAGPPGPPGKRGPPGAAGAEGRQGEKGAKGEAGAEGPPGKTGPVGPQGPAG
KPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIG
PPGEQGEKGDRGLPGTQGSPGAKGDGGIPGPAGPLGPPGPPGLPGPQGPKGNKGSTGPAG
QKGDSGLPGPPGPPGPPGEVIQPLPILSSKKTRRHTEGMQADADDNILDYSDGMEEIFGS
LNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFT
SGGETCIYPDKKSEGLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAACYDKAL
RFLGSNDEEMSYDNNPFIKALYDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDFGDQN
QKFGFEVGPVCFLG
Download sequence
Identical sequences ENSMMUP00000005486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]