SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005583 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005583
Domain Number 1 Region: 287-711
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.79e-108
Family Phosphofructokinase 0.00000709
Further Details:      
 
Domain Number 2 Region: 26-300
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.85e-84
Family Phosphofructokinase 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005583   Gene: ENSMMUG00000004935   Transcript: ENSMMUT00000005928
Sequence length 723
Comment pep:known_by_projection chromosome:MMUL_1:9:3370993:3406280:1 gene:ENSMMUG00000004935 transcript:ENSMMUT00000005928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVRGDWREPGHWSHHFPCPGRRAWWSGGTIIGSARCQAFRTREGRLKAACNLLQRGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEQGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECV
QMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKR
ILPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGAD
AAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVLG
ISKRNVIFQPVAELKQQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQP
WSV
Download sequence
Identical sequences ENSMMUP00000005583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]