SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005591 from Macaca mulatta 76_1

(show help)
Strong hits

Sequence:	ENSMMUP00000005591
Domain Number 1	Region: 59-120
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	2.62e-16
Family	LIM domain	0.002
Further Details:

Domain Number 2	Region: 117-180
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.57e-16
Family	LIM domain	0.0011
Further Details:

Domain Number 3	Region: 23-57
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000057
Family	LIM domain	0.00087
Further Details:

Weak hits

Sequence:	ENSMMUP00000005591
Domain Number -	Region: 176-205
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0173
Family	LIM domain	0.024
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000005591 Gene: ENSMMUG00000004179 Transcript: ENSMMUT00000005936
Sequence length	234
Comment	pep:known chromosome:MMUL_1:13:134098372:134103950:-1 gene:ENSMMUG00000004179 transcript:ENSMMUT00000005936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	WALLHPANPEGRGHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCT HCGKELTAEARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKC EKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCN SKLTLKNKFVEFDMKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPKAADLNSA
Download sequence
Identical sequences	ENSMMUP00000005591

SEARCH