SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005592 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005592
Domain Number 1 Region: 43-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-17
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 166-227
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.39e-16
Family LIM domain 0.002
Further Details:      
 
Domain Number 3 Region: 224-287
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.46e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 130-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000025
Family LIM domain 0.00087
Further Details:      
 
Domain Number 5 Region: 6-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000257
Family LIM domain 0.0028
Further Details:      
 
Domain Number 6 Region: 101-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000492
Family LIM domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005592
Domain Number - Region: 283-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0168
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005592   Gene: ENSMMUG00000004179   Transcript: ENSMMUT00000005937
Sequence length 341
Comment pep:known chromosome:MMUL_1:13:134098370:134135378:-1 gene:ENSMMUG00000004179 transcript:ENSMMUT00000005937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSNMSDALANAVCQRCQARFAPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEG
RKYCEHDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNASR
HLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEAREL
KGELYCLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKK
GLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFD
MKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPKAADLNSA
Download sequence
Identical sequences I2CUQ1
ENSMMUP00000005592 NP_001252623.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]