SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005689 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000005689
Domain Number - Region: 88-132
Classification Level Classification E-value
Superfamily ISP domain 0.0641
Family Rieske iron-sulfur protein (ISP) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005689   Gene: ENSMMUG00000004258   Transcript: ENSMMUT00000006045
Sequence length 235
Comment pep:known_by_projection chromosome:MMUL_1:3:5281497:5336763:-1 gene:ENSMMUG00000004258 transcript:ENSMMUT00000006045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLVSGPLKVVFLVLASLCAWYSGYLLAELIPDAPLSSAAYSIHSIGERPVLKAPVPKR
QKCDHWTPCPSDTYAYRLLSGGGINKYAKICFEDDLLMGEKLGNVARGINIAIVNYVTGN
VTATQHFDMYEGDNSGPMIKFIQSAPPKSLLFMVTYDDGSTRLNNDAKNAIEELGSKEIR
NMKFRSSWVFLAAKGFELPSEIQREKINHSDTKNNRYSGWPAEIQIEGCIPKEPS
Download sequence
Identical sequences A0A096NIY2 A0A2K5X134 A0A2K6CSB9 H9ZA89
XP_005548710.1.63531 XP_011724297.1.29376 XP_014988334.1.72884 ENSPANP00000012930 ENSMMUP00000005689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]