SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005690 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000005690
Domain Number - Region: 40-84
Classification Level Classification E-value
Superfamily ISP domain 0.0419
Family Rieske iron-sulfur protein (ISP) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005690   Gene: ENSMMUG00000004258   Transcript: ENSMMUT00000006046
Sequence length 187
Comment pep:known_by_projection chromosome:MMUL_1:3:5281513:5336684:-1 gene:ENSMMUG00000004258 transcript:ENSMMUT00000006046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLVSAPVPKRQKCDHWTPCPSDTYAYRLLSGGGINKYAKICFEDDLLMGEKLGNVARG
INIAIVNYVTGNVTATQHFDMYEGDNSGPMIKFIQSAPPKSLLFMVTYDDGSTRLNNDAK
NAIEELGSKEIRNMKFRSSWVFLAAKGFELPSEIQREKINHSDTKNNRYSGWPAEIQIEG
CIPKEPS
Download sequence
Identical sequences A0A2I3MT98 A0A2K5X141 A0A2K6CSD0 F6YNL3
ENSMMUP00000005690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]