SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005714 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005714
Domain Number 1 Region: 161-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 2 Region: 423-493
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000177
Further Details:      
 
Domain Number 3 Region: 49-125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005714   Gene: ENSMMUG00000004271   Transcript: ENSMMUT00000006070
Sequence length 507
Comment pep:known_by_projection chromosome:MMUL_1:7:89330662:89479984:-1 gene:ENSMMUG00000004271 transcript:ENSMMUT00000006070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYA
AGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKI
REMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPN
STAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQK
IQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAF
PAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAAN
LLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGS
KDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAA
TQAAQYLITQRITYEQGVRAANPQKVG
Download sequence
Identical sequences A0A096NXD9 A0A0D9RTF4 A0A0P6JI63 A0A151MW36 A0A1S3AJZ0 A0A1S3FXN7 A0A1V4KH27 A0A218V827 A0A287A9A5 A0A2I0UTU9 A0A2I3HV42 A0A2I3SEW0 A0A2K5N9I3 A0A2K5QNB8 A0A2K6DE72 F6ZSR6 G1TE26 G3RRA1 G3SY74 G3X7R5 G7PA04 H0ZNI3 H2NKY1 J9NXS6 M3W1T2 M3Y270 R4GG35 U3E811 U3JT37
ENSCAFP00000038092 ENSMPUP00000005421 ENSOCUP00000015132 ENSLAFP00000005418 ENSLAFP00000005418 ENSNLEP00000018915 ENSMPUP00000005421 NP_001186641.1.86415 NP_001248729.1.72884 XP_001170675.1.37143 XP_002200539.1.42559 XP_002753741.1.60252 XP_002824680.1.23681 XP_003260754.1.23891 XP_003408555.1.64505 XP_003792040.1.62490 XP_003987575.1.62641 XP_004055087.1.27298 XP_004283152.1.21590 XP_004376597.1.4749 XP_004406592.1.74151 XP_004421209.1.5094 XP_004584790.1.84141 XP_004661905.1.11716 XP_004682023.1.23501 XP_004755217.1.14098 XP_004864109.1.39548 XP_005047321.1.66865 XP_005309818.1.60341 XP_005343869.1.66349 XP_005520376.1.90289 XP_005561061.1.63531 XP_005873354.1.60319 XP_005901092.1.15283 XP_006266790.1.47583 XP_006740679.1.47382 XP_006835435.1.41390 XP_006890024.1.29581 XP_006975317.1.50099 XP_007536151.1.11023 XP_007947440.1.48129 XP_007984552.1.81039 XP_008267680.1.1745 XP_010572537.1.12557 XP_010841693.1.44457 XP_011374240.1.92234 XP_011733079.1.29376 XP_011946511.1.92194 XP_012007667.1.54773 XP_012411052.1.4749 XP_012502749.1.63892 XP_012628939.1.48125 XP_012880804.1.60039 XP_013365898.1.28644 XP_014121675.1.73095 XP_014746928.1.99236 XP_015263592.1.55130 XP_015485911.1.82291 XP_015720399.1.68032 XP_016005788.1.101085 XP_017393053.1.71028 XP_017675922.1.3805 XP_017921812.1.57651 XP_019284798.1.44245 XP_019374478.1.87953 XP_020645051.1.8467 XP_020859954.1.61212 XP_020954849.1.46622 XP_021257583.1.32913 XP_021394994.1.53032 XP_021551132.1.83697 XP_547754.1.84170 ENSPANP00000017733 ENSCAFP00000038092 ENSBTAP00000041566 ENSPPYP00000006496 ENSPTRP00000010571 ENSFCAP00000003894 ENSMMUP00000005715 ENSVPAP00000007263 59729.ENSTGUP00000012159 9544.ENSMMUP00000005714 9598.ENSPTRP00000010571 9600.ENSPPYP00000006496 9615.ENSCAFP00000018401 ENSPTRP00000010571 ENSMMUP00000005714 ENSBTAP00000041566 ENSPPYP00000006496 ENSFALP00000005941 ENSGALP00000040996 ENSVPAP00000007263 ENSNLEP00000018915 ENSTGUP00000012159 ENSTGUP00000012159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]