SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005715 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005715
Domain Number 1 Region: 138-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 2 Region: 399-469
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000177
Further Details:      
 
Domain Number 3 Region: 49-125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005715   Gene: ENSMMUG00000004271   Transcript: ENSMMUT00000006071
Sequence length 483
Comment pep:known_by_projection chromosome:MMUL_1:7:89330683:89479960:-1 gene:ENSMMUG00000004271 transcript:ENSMMUT00000006071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYA
AGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKI
REMPQNVAKTEPVSILQPQTTVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAW
VQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVAN
SNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLAS
YGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFA
LGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL
VEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQ
KVG
Download sequence
Identical sequences A0A1S3AJQ2 A0A1S3FWP3 A0A2I2UUY1 A0A2I2ZVW4 A0A2I3HMI5 A0A2I3NG33 A0A2I3TJN7 A0A2J8TQZ8 A0A2K5N9B6 A0A2K5QN64 A0A2K6DE88 F1SGT5 F7HNQ2 H9FUX9 Q25JH4 Q2PFW9 R4GH08
ENSCJAP00000011435 ENSMMUP00000005715 NP_001186642.1.86415 NP_001274225.1.63531 XP_001170656.1.37143 XP_002200538.1.42559 XP_002753742.1.60252 XP_003260755.1.23891 XP_003408554.1.64505 XP_003792041.1.62490 XP_004055088.1.27298 XP_004283153.1.21590 XP_004376598.1.4749 XP_004406593.1.74151 XP_004584791.1.84141 XP_004661906.1.11716 XP_004755218.1.14098 XP_004864111.1.39548 XP_005047322.1.66865 XP_005309819.1.60341 XP_005343870.1.66349 XP_005901093.1.15283 XP_006740680.1.47382 XP_006835436.1.41390 XP_006890025.1.29581 XP_006975318.1.50099 XP_007536160.1.11023 XP_007947441.1.48129 XP_007984553.1.81039 XP_010572538.1.12557 XP_011374241.1.92234 XP_011733080.1.29376 XP_011946513.1.92194 XP_012502750.1.63892 XP_012628940.1.48125 XP_012880805.1.60039 XP_014964998.1.54773 XP_014998846.1.72884 XP_015485912.1.82291 XP_015720400.1.68032 XP_016005789.1.101085 XP_017203724.1.1745 XP_017393054.1.71028 XP_017675923.1.3805 XP_017921813.1.57651 XP_019284799.1.44245 XP_019351738.1.47583 XP_019374479.1.87953 XP_019688443.1.62641 XP_020645052.1.8467 XP_020859957.1.61212 XP_020954850.1.46622 XP_021257584.1.32913 XP_021394995.1.53032 XP_021551133.1.83697 XP_860979.2.84170 ENSGALP00000041336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]