SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005794 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005794
Domain Number 1 Region: 414-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.52e-54
Family Eukaryotic proteases 0.00055
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-32
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000312
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005794   Gene: ENSMMUG00000004330   Transcript: ENSMMUT00000006153
Sequence length 720
Comment pep:known chromosome:MMUL_1:14:36301847:36401906:1 gene:ENSMMUG00000004330 transcript:ENSMMUT00000006153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHTKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDNRDGQIIKRVCGNERPAPIQSTGSSLHVLFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEERNCSDPGGPVNGYKKITGGPGLI
NGHHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICIKACREPKISDLVRRRVL
PMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLPTGYQHLHTQLQYECISPFYR
RLGSSRRTCLRTGKWSGRAPSCIPICGKIENVTAPKTQGLRWPWQAAIYRRTSGVHDGSL
HKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTIQS
LRISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAASRDLSTSFQESHITVAG
WNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIPVSVTDNMFCASQDPTAPSDI
CTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLSTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences F6ZDC8
ENSMMUP00000005794 XP_001114993.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]