SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005800 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005800
Domain Number 1 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 527-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000034
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 200-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000368
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 336-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000119
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 149-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000265
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 573-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000374
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005800   Gene: ENSMMUG00000004337   Transcript: ENSMMUT00000006161
Sequence length 635
Comment pep:known chromosome:MMUL_1:19:43293388:43298910:-1 gene:ENSMMUG00000004337 transcript:ENSMMUT00000006161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHLMMFRDVAVDFCQEEWECLDLEQRDLYRDVMLENYSNLVSLGLCIYQPEVFSLLEKGK
EPWKILRDETRGPCPDMQSRCQTKKLLPKNGICEREIAQLEIMKICKNHSLECLCFRGDW
EGNVQFQTLQDNQEECFKQVILTCEKRPTFNQHTAFNLHQRLNTGDKLNEFKELGKAFIS
GSDHTQHQLIHTIVKFCEDKECENTFLPDSEVTQHQTVHTVKKTYECKECGKSFSLRSSL
TGHKRIHTGEKPFKCKECGKAFRFHSQLSVHKRIHTGEKSYECKECGKAFSCGSDLTRHQ
RIHTGEKPYECNECRKAFSQRSHLIKHQRIHTGEKPYECQECGKAFTRGSHLTQHQRIHT
GEKSHECKECGKAFIRGSNLAQHQNVHVGRKPYECEKCGKAYIWSSHLARHQRIHTGRKP
YECKQCGKTFTWPSYLAQHEKIHNERKSYECKDCGKTFLHGSEFNRHQKIHTGERDYECK
ECGKTFLRGSELNRHQKIHTGKRPYECEECGKAFLWGSQLTRHQRMHTGEEPYVCKECGK
SFIWGSQLTRHKRIHTDAEPYGCKKSSHIFSHHSYFTEQKIHNGANLCEWTDYGNSFSHE
SSFAQHQNIYTFEKSYEFKDFEKAFSSSSHFISLL
Download sequence
Identical sequences ENSMMUP00000005800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]