SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005866 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005866
Domain Number 1 Region: 378-481
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-28
Family Cadherin 0.0027
Further Details:      
 
Domain Number 2 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.00046
Further Details:      
 
Domain Number 3 Region: 261-356
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 481-589
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 82-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000514
Family Cadherin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005866   Gene: ENSMMUG00000004389   Transcript: ENSMMUT00000006235
Sequence length 790
Comment pep:known chromosome:MMUL_1:6:19524948:19874297:-1 gene:ENSMMUG00000004389 transcript:ENSMMUT00000006235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITSTSCICPVLVCLCFVQRCYGTAHHSSIKVTRNQTKHIEGETEVHHRPKRGWVWNQF
FVLEEHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQ
KTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDMGTSVLQ
VTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQAKD
MAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADTGSN
ADMTYSIINGDGMGIFSISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSH
LGPFKDATMLKIIVGDVDEPPLFSMPSYVMEVYENAKIGTVVGTVLAQDPDSANSLVRYF
INYNAEDDRFFNIDANTGTIKTTKVLDREETPWYNITVTASENDNPDLLSHVTVGIRVLD
VNDNPPELAREYDIVVCENSKPGQVIHTISATDKDDFANGPRFNFFLDEHLPVNPNFTLK
DNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTC
HAEAFLSSAGLSTGALIAILLCVLILLAIVVIFITLRRSKKEPLIISEEDVRENVVTYDD
EGGGEEDTEAFDITALRNPSAAEELKYRRDIRPEVKLTPRHQTLSTLESIDVQEFIKQRL
AEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYHYLGDWGPEFKKLAEL
YGEIESERTT
Download sequence
Identical sequences A0A2K5NBK4 A0A2K5UPM6 A0A2K6C316 F7FMS7
XP_001088306.1.72884 XP_005556674.1.63531 XP_011716076.1.29376 XP_011716077.1.29376 XP_011716078.1.29376 XP_011716079.1.29376 XP_011932682.1.92194 XP_011932683.1.92194 XP_011932684.1.92194 XP_011932685.1.92194 XP_011932686.1.92194 XP_011932687.1.92194 XP_011932689.1.92194 XP_011932690.1.92194 XP_011932691.1.92194 XP_011932692.1.92194 XP_014995243.1.72884 XP_014995244.1.72884 XP_014995245.1.72884 XP_014995246.1.72884 XP_015306716.1.63531 XP_015306717.1.63531 XP_015306718.1.63531 XP_015306720.1.63531 XP_015306721.1.63531 XP_015306722.1.63531 ENSMMUP00000005866 9544.ENSMMUP00000005866 ENSMMUP00000005866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]