SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005883 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005883
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 3.52e-34
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005883   Gene: ENSMMUG00000004405   Transcript: ENSMMUT00000006253
Sequence length 138
Comment pep:known chromosome:MMUL_1:19:17898070:17907312:-1 gene:ENSMMUG00000004405 transcript:ENSMMUT00000006253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYI
RGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIP
GTGRGQPEKKPGRQAGKQ
Download sequence
Identical sequences G7PWZ1
9544.ENSMMUP00000005883 9685.ENSFCAP00000007321 ENSMMUP00000005883 ENSFCAP00000007321 ENSMMUP00000005883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]