SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005913 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005913
Domain Number 1 Region: 368-535
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-32
Family ABC transporter ATPase domain-like 0.0063
Further Details:      
 
Domain Number 2 Region: 101-291
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-29
Family ABC transporter ATPase domain-like 0.016
Further Details:      
 
Domain Number 3 Region: 6-145
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000015
Family Short-chain ferredoxins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005913   Gene: ENSMMUG00000004433   Transcript: ENSMMUT00000006286
Sequence length 599
Comment pep:known chromosome:MMUL_1:5:137297757:137321477:1 gene:ENSMMUG00000004433 transcript:ENSMMUT00000006286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGI
CIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTAL
KILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAA
KGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMF
DEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT
MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEF
ELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPA
DVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPS
KNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
Download sequence
Identical sequences A0A1S3G843 A0A212D996 A0A2K5CPK4 A0A2K6TM06 F7GPG0 F7INY7 G1SG72 G2HF28 H0V9Y4 P61221 P61222 Q3UHY8
ENSP00000296577 ENSMMUP00000005913 5lzv_jj 6hcf_k1 6hcm_k1 ENSCJAP00000043985 ENSCPOP00000006643 NP_001035809.1.87134 NP_001035809.1.92137 NP_001233538.1.37143 NP_001253883.1.72884 NP_002931.2.87134 NP_002931.2.92137 NP_056566.2.92730 XP_002745362.1.60252 XP_005006844.1.53824 XP_005345450.1.66349 XP_005386690.1.28644 XP_006169561.1.99106 XP_006971794.1.50099 XP_008265616.1.1745 XP_008825705.1.79516 XP_008967104.1.60992 XP_008967105.1.60992 XP_009446589.1.37143 XP_010336937.1.74449 XP_010609247.1.5607 XP_012309414.1.9421 XP_012884993.1.60039 XP_014994762.1.72884 XP_017501173.1.32401 XP_017501174.1.32401 XP_020753905.1.74333 XP_020753906.1.74333 XP_020753907.1.74333 XP_021075641.1.100879 399876 ENSMUSP00000079379 ENSOCUP00000001567 ENSPTRP00000028293 10090.ENSMUSP00000079379 10141.ENSCPOP00000006643 9544.ENSMMUP00000005913 9598.ENSPTRP00000028293 9606.ENSP00000296577 9986.ENSOCUP00000001567 ENSOCUP00000001567 ENSCJAP00000004823 ENSP00000296577 ENSMUSP00000079379 ENSCPOP00000006643 ENSP00000296577 ENSMUSP00000079379 ENSMMUP00000005913 gi|108773782|ref|NP_002931.2| gi|108773784|ref|NP_001035809.1| ENSPTRP00000028293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]