SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005970 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005970
Domain Number 1 Region: 371-460
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 258-370
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000371
Family Cadherin 0.003
Further Details:      
 
Domain Number 3 Region: 146-235
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000971
Family Cadherin 0.00072
Further Details:      
 
Domain Number 4 Region: 61-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000614
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 477-584
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000271
Family Cadherin 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005970
Domain Number - Region: 573-641
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0033
Family Rhodopsin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005970   Gene: ENSMMUG00000004479   Transcript: ENSMMUT00000006347
Sequence length 790
Comment pep:known_by_projection chromosome:MMUL_1:10:18232212:18308394:1 gene:ENSMMUG00000004479 transcript:ENSMMUT00000006347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRPEGRGLRAGAALSPGRLWAAGTPAPSAPGARQDGALGAGRVKRGWVWNQFFVVEEY
TGTEPLYVGKIHSDSDEGDGAIKYTISGEGAGTIFLIDELTGDIHAMERLDREQKTFYTL
RAQARDRATNRLLEPESEFIIKVQDINDSEPRFLHGPYIGSVAELSPTGTSVMQVMASDA
DDPTYGSSARLVYSMLDGEHHFTVDPKTGGVIRTAVPDLDREPSQRKQVILTSTSALVGK
QAATTVNINSKISMKPHHFNTKMYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKE
ESGSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVHTVILEALNKFVDPRFADLGTFRDQ
AIVRVAVTDVDEPPEFRPPSRLLEVQEDAQVGSLVGVVTARDPDAANRPVRYAIDRESDL
DQIFDIDADTGAIVTGKGLDRETAGWHNITVLAMEADYHKQLPRTNHRFQFQIVQSNPPS
IIQKKDQEEVREAEPKQRCYNGGLIHNEDPGGDHPLTFQLVPEAPSNPHFSLLDIQGTDN
TAAVHTQHVGFNRQEQDVFFLPILVVDSGPPTLSSTGTLTIRICGCDSSGTIQSCNTTAF
VMAASLSPGALIALLVCVLILVVLVLLILTLRRHHKSHLSSDEDEDMRDNVIKYNDEGGG
EQDTEAYDMSALRSLYDFGELSPPQAHLPSERHSLPQGPPSPEPDFSVFRDFISRKVALA
DGDLSVPPYDAFQTYAFEGADSPAGSLSSLHSGSSGSEQDFAYLSSWGPRFRPLAALYAG
HRGDDEAQAS
Download sequence
Identical sequences 9544.ENSMMUP00000005970 ENSMMUP00000005970 ENSMMUP00000005970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]