SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005993 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000005993
Domain Number - Region: 168-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0425
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005993   Gene: ENSMMUG00000004495   Transcript: ENSMMUT00000006370
Sequence length 533
Comment pep:known_by_projection chromosome:MMUL_1:10:83408189:83409846:1 gene:ENSMMUG00000004495 transcript:ENSMMUT00000006370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQA
SPEPGDPDLLRTPLYSHSPLLQPLPPSKAAEELHRVDLELPEDTTEYFVRTKAGGVHFKP
GTKMLERMPPGRPEEKPEGANGSSTRRPPRYLLSARERTGGRGARRKWVECVCLPGWHGP
SCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCES
NFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTQDG
VSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWKQPGTLE
VVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCS
WCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEH
MYAPKYLLKNYDQFRYLLDNPYQEPRSTAAGGRRHRGPEGRLPARGKLDEAEG
Download sequence
Identical sequences ENSMMUP00000005993 ENSMMUP00000005993 9544.ENSMMUP00000005993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]