SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006055 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006055
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000133
Family Glutathione S-transferase (GST), N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006055   Gene: ENSMMUG00000004556   Transcript: ENSMMUT00000006441
Sequence length 68
Comment pep:novel scaffold:MMUL_1:1099548049568:418260:423835:-1 gene:ENSMMUG00000004556 transcript:ENSMMUT00000006441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALELYMDLLSAPCRAVYIFSKKHDIRFNFQFVDLLKGHHHSKEYIDINPLRKLPSLKDG
KFILSESC
Download sequence
Identical sequences H2P518
ENSPPYP00000013425 ENSMMUP00000006055 ENSMMUP00000027619 ENSMMUP00000041013 ENSMMUP00000006055 ENSMMUP00000027619 ENSPPYP00000013425 9544.ENSMMUP00000006055 9544.ENSMMUP00000027619 9600.ENSPPYP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]