SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006172 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006172
Domain Number 1 Region: 101-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000439
Family VWC domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006172   Gene: ENSMMUG00000004640   Transcript: ENSMMUT00000006562
Sequence length 164
Comment pep:known chromosome:MMUL_1:15:104414610:104421014:-1 gene:ENSMMUG00000004640 transcript:ENSMMUT00000006562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVLFCFFLLIIFQTDFGQNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGTPQTTI
FTPVARFPVVNFDYGMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEP
CTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATGIEI
Download sequence
Identical sequences 9544.ENSMMUP00000006172 ENSMMUP00000006172 ENSMMUP00000006172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]