SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006214 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006214
Domain Number 1 Region: 781-890
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.09e-30
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006214
Domain Number - Region: 891-925
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00425
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006214   Gene: ENSMMUG00000004675   Transcript: ENSMMUT00000006605
Sequence length 936
Comment pep:known_by_projection chromosome:MMUL_1:10:74964024:74985150:1 gene:ENSMMUG00000004675 transcript:ENSMMUT00000006605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELEREEEALASKRFRAERQD
NKENWLHSRQREAEQRVALARLAGQLESMNDVEELTALLRSAGEYEERKLIRAAIRRVRA
QEIEAATLAGRLCSARPNSGLREDSKGRVAHRLEQCEVPEREEQEQQTEVSKPTPTPEGT
SQDVTTVTLLLRAPPGSTSSSPASASSSPTAASPEPPLEPAEAQCLTAEVPGAPEPPPSP
PKTTSPEPQESPTLTSTEGQVVNKLLSGPKETPAAQSPTRGPSDTKRADVAGPRPCQRSL
SVLSPHQPAQNRESTPLASRPSSFQRAGSVRDRVHKFTSDSLMAARLQDGTPRAALSPLP
RKARGPLPHQYHPCLLLQRLLLSGPDTSSRFSKEQQGVAQPLAQLRSCSQEEGPRGRGLA
PRPLENGAGGPVARSEEPGAPLPVAVSTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTG
NQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGTLARLGSVTHVTSFSHAPPSSRGGCS
VKMEPEPAEPPSAAVEAANGAEQTRVNKAPEGRSPLSAEELMTIEDEGVLDKMLDQSTDF
EERKLIRAALRELRQRKRGREPAEAQESLESGRQRLHGHNSIEALERPTYHTELPGGTAT
CQYLQTMNRIRIQDGNQRGPGTLSQRDYTPSSSRVVAQAGEQPSSPCLTCISPTPSIFDR
EDQTSPRAGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPR
AAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPE
AFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKMLVDCVPLVEVED
MMIMGKKPDPKCVFTYVQSLYNHLRRHELRLRGKNV
Download sequence
Identical sequences ENSMMUP00000006214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]