SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006236 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006236
Domain Number 1 Region: 39-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-33
Family MAM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 208-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-22
Family MAM domain 0.0028
Further Details:      
 
Domain Number 3 Region: 1369-1429
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000965
Family BSTI 0.025
Further Details:      
 
Domain Number 4 Region: 2159-2219
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000154
Family ATI-like 0.045
Further Details:      
 
Domain Number 5 Region: 1755-1817
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000327
Family BSTI 0.039
Further Details:      
 
Domain Number 6 Region: 2654-2689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000212
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 7 Region: 991-1043
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000458
Family ATI-like 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006236
Domain Number - Region: 372-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0348
Family MAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006236   Gene: ENSMMUG00000022840   Transcript: ENSMMUT00000006627
Sequence length 2733
Comment pep:novel chromosome:MMUL_1:3:48028737:48091523:1 gene:ENSMMUG00000022840 transcript:ENSMMUT00000006627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPPVWTLLLLVGAAHLRREKPPDKKLVVRISGNNYVLTQCDFEDDAKPLCDWSQVSADD
GDWVRASGPSPTGTTGPPGGYPNGEGSYLHMESNNFHRGGVARLRSPNLWEQGPLCVNFA
YHMFGLSWGAQLRLLLLSGEEGRRPHVLWKHRNTQRPSWMPTTVTVPAGFTLPTRLMFEG
TRGSTAYLDIALDALSIRRGSCNRVCMMQTCSFDIPNDLCDWTWIPTASGAKWTQKKGSS
GKPGVGPDGDFSNPGSGHYMLLDPKNARPGQKAVLLSPVSPSSGCLSFSFHYVLRGQSPG
AALHVYASVLGSIRKHTLFSGQPGPNWQAVSVNYTAVGRIQFTVVGVFGKTPEPAVAVDA
TSIAPCGEGFPQCDFEDNAHPFCDWVQTSGDGGHWAVGHKNGPVHGMGPVGGFPNAGEEI
EERSRQGITHGLAAVTVQAPGRGQCPEITIPQGSLYDLLKMQVLAGCGGSSLPRRADHEV
RRSRPSWLTRLGVGIAHWSPLQLDGSEEGGGMVLTKLQGFFFFFFSVKMLPELPPISPVS
STGPSETTGLTENPTVSIEKPTVTTEKPTVPKEKPTIPAEKPTIPTEEPSFATEKPTILT
EEPTIPTEKPTTPSEKPTIPTEEPSFPTEKPTIPTEEPTIPTEKPTISTEEPTIPTEKPT
ISTEKPTVPAEEPTTTTEETTISTEEAAIPTEKPTVPMEKPTIPTEETTTSIEETTISVE
KPTIPTEKPTIPTEKPTIPTEKPTISIEETTISTEKPTISTEKPTIPTEKSTIPTEKATI
PTEKPTISTEKPTIPTEKPTIPIEETIISTEKPTIPTEKPIPTEKSTISTEKPTIPIEET
IISTEKPTIPIEETIISTEKPTIPTEKPTISTEKPTIPIEETIISTEKPTIPTEKPTIPT
EKPTIPTEKPTIPTEKPTIPTEKTTISPEKPTIPTEKPTIPTEKLTALRPPHPSPTATGV
AALVMSPHAPSAAMTSVILSTNTTPRPNTERCPPNAHYESCACPASCKSPRPSCGPLCRG
GCVCNLGFLFSDNHCIQASSCNCFYNNNYYEPGAEWFSPNCTERCRCWPGSRVECQISQC
GTHTVCQLKNGQYGCHPYAGTTTCLVYGDPHYVTFDGRHFGFMGKCSYILAQPCGNSTDP
FFRVTAKNEEQGQEGVSCLSKVYVTLPETTVTLLKGRRTLVEGQRVTLPAIPSKGVFLGA
SGRFVELQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGNYDGNSDNDHLKSDGSPAGD
KEELGNSWQTDQDEDQECQKHQVVNPPSCDSSLQSNMSGPGFCGRLVDTRGPFETCLLHV
KATSFFDSCMLDMCRFQGLQHLLCTHMSTMTTTCQDAGHAVKPWREPQFCPMACPPNSKY
SLCAKPCPDTCHSGFTGMFCSDRCVEACECNPGFVLSGLECVPRSQCGCLHPAGSYFKVG
ERWYKPGCKELCVCESNNRIRCQPWRCRAQEFCGLQDGIYGCHAQGAATCTASGDPHYLT
FDGALHHFMGTCTYVLTRPCWSRSQDSYFVVSATNENRGGSLEVSYVKAVHVTVFDLSIS
LLRGCKVMLNGHRVALPVWPAQGRVTIRLSSNFVLLYTNFGLQVRYDGSHLVEVTVPSSY
GGQLCGLCGNYNNNSLDDNQRPDRKPAGDSVQLGAAWKLPESSEPGCFLVGGKPSSCQEN
SMADAWNKNCAILINPQGPTSVFHHVVPPQSSFASCMHGQCGTKGDTTALCHSLQAYASL
CARAGQAPAWRNRTFCPMRCPPGSSYSPCGSPCPATCSSLNDPRDCPKALPCAESCECQK
GYILSGTSCVPLGQCGCTEPAGSYHPVGERWYTEDTCTRLCTCSIHNNITCFQSTCKPNQ
MCWALDGLLRCRASGMGVCQLPGESHYVSFDGSNHSIRDTCTHVLVKVCHPAMALPFFKI
SAKHEKEEGGTKAFRLHEVYINIYDAQVTLQKGHRVLINSKKVTLPAISQIPGVSVKSSS
IYTIVNIKIGVQVKFDGNHLLEIELPTTYYGKVCGVCGNFNDEEEDELMMPSDELAHSDS
EFVNSWKDKDIDPRFSCLSLPNHATELQPGRQSETLSPNKPKPKISWVWPRWADHLRSGV
RDQSGQHGETLSLLKIQKLAECGGMLRQENCLNPGGGSCSEPRLCHCTPARVKRSKLSLE
CPAYSSYTNCLPSCSPSCWDLDGRCEGAKVPSACAEGCICQPGYVLSEDKCVPRSQCGCK
DAHGGSIPLGKSWVSRGCTEKCVCTGGAIQCGDFRCPSGSHCQLSSDNSNSNCVSDKSEQ
CSVYGDPHYLTFDGFSYRFRGRMTYVLIKTVDVLPEGVEPLLVEGRNKMDPPRSSTFLQE
VITTVYGYKVQLQAGLELVVNNQKMAVPYRPNEHLRVTLRGQRLYLVTDFELVISFGGRK
NAVISLPSMYEGLVRGLCGNYDNNRKNDMMLPSGALTRNLNTFGDSWEVKTEDVLLRFPR
AIPVEERRGVELGLRVSECSPEQLASNSTQACRVLADPQGPFAACHQTVAAEPFQEHCVL
DLCSTQDPREQEELRCQVLSGHGVSSRYYVSELYDTLPSVLCQPGGPRGLRRPLCGRLCQ
HPRLCLQRHPEPPADCGCTSNGIYYQLGSSFVTEDCSQRCTCASSRILLCEPFSCREGEV
CTLGNHTRGCFPESPCLRNPCQNDGQCQEQGATFTCDCEVGYGGDLCTEPRDVPPPRKPA
SNPVAVLLGLLVPVVVVVLAVTRECIYRMRRKR
Download sequence
Identical sequences ENSMMUP00000006236 9544.ENSMMUP00000006236 ENSMMUP00000006236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]