SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006239 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006239
Domain Number 1 Region: 130-510
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.12e-123
Family Choline/Carnitine O-acyltransferase 0.00000000000198
Further Details:      
 
Domain Number 2 Region: 512-724
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.34e-79
Family Choline/Carnitine O-acyltransferase 0.00000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006239   Gene: ENSMMUG00000004692   Transcript: ENSMMUT00000006632
Sequence length 750
Comment pep:known_by_projection chromosome:MMUL_1:9:46975893:47027746:-1 gene:ENSMMUG00000004692 transcript:ENSMMUT00000006632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLRTAKKREEGGLGGGRKCKREEGGGTRGRREVRPACFLQSGGRGDLGDVGGPAQNPGGS
PHPRAATRPPPLPAHTPAHTPEWCGAAAAKAAEPRRAGPHCIPGSGLTKTPILEKVPHNM
AAKTPSSEEESGLPKLPVPPLRQTLATYLQCMRHLVPEEKFRKSQAIVQRFGAPGGLGET
LQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASL
ISGVLSYKALLDSHSIPTDYAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIM
PEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGR
SEWAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGA
NRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELP
APRRLRWKCSPEIQGHLASSAENLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVA
LQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAMTDHKAAVLASEKLL
LLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAVCKEMPEMFMDETYLMSNRFVLSTS
QVPTTMEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDM
RDLCSLPPPAESKPLATKEKAMRLSQEHQP
Download sequence
Identical sequences ENSMMUP00000006241 ENSMMUP00000006239 9544.ENSMMUP00000006239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]