SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006242 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006242
Domain Number 1 Region: 11-391
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4e-123
Family Choline/Carnitine O-acyltransferase 0.00000000000198
Further Details:      
 
Domain Number 2 Region: 393-605
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.12e-79
Family Choline/Carnitine O-acyltransferase 0.00000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006242   Gene: ENSMMUG00000004692   Transcript: ENSMMUT00000006635
Sequence length 631
Comment pep:known_by_projection chromosome:MMUL_1:9:46975951:47026181:-1 gene:ENSMMUG00000004692 transcript:ENSMMUT00000006635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKTPSSEEESGLPKLPVPPLRQTLATYLQCMRHLVPEEKFRKSQAIVQRFGAPGGLGE
TLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAAS
LISGVLSYKALLDSHSIPTDYAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSI
MPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDG
RSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNG
ANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSEL
PAPRRLRWKCSPEIQGHLASSAENLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQV
ALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAMTDHKAAVLASEKL
LLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAVCKEMPEMFMDETYLMSNRFVLST
SQVPTTMEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLID
MRDLCSLPPPAESKPLATKEKAMRLSQEHQP
Download sequence
Identical sequences ENSMMUP00000006241 ENSMMUP00000006242 ENSMMUP00000006282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]