SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006301 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006301
Domain Number 1 Region: 64-183,259-364
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.62e-64
Family FabD-like 0.0000947
Further Details:      
 
Domain Number 2 Region: 191-266
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000222
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006301   Gene: ENSMMUG00000004740   Transcript: ENSMMUT00000006697
Sequence length 390
Comment pep:known chromosome:MMUL_1:10:87112002:87124190:-1 gene:ENSMMUG00000004740 transcript:ENSMMUT00000006697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVARTAWARGLGASGRRGVSSFPVPPPGAQDVAELLRDATGAEEEAPSAATERRMPG
QCSVLLFPGQGSQVVGMGRGLLGYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHC
QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAE
AMQEASEAVPSGMLSVLGQPQSEFNFACLEAREHCKSLGMENPVCEVSNYLFPDCRVISG
HREALRFLQKNSSKFHFRRARMLPVSGAFHTRLMEPAVEPLTQVLKAIDIKKPLVSVYSN
VHGHRYMHPSHIQKLLAQQVVSPVKWEQTMHAIYERKKGREFPQTFEVGPGRQLGAILKS
CNMQAWKSYSAVNVLQTLEPVDLDPEEPPR
Download sequence
Identical sequences A0A2K5WF41 F6SUC4
9544.ENSMMUP00000006301 ENSMMUP00000006301 ENSMMUP00000006301 NP_001248301.1.72884 XP_005567130.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]