SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006314 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006314
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily POZ domain 4.45e-23
Family BTB/POZ domain 0.0071
Further Details:      
 
Domain Number 2 Region: 236-260,344-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000351
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006314   Gene: ENSMMUG00000004747   Transcript: ENSMMUT00000006710
Sequence length 435
Comment pep:known chromosome:MMUL_1:7:127484714:127505885:-1 gene:ENSMMUG00000004747 transcript:ENSMMUT00000006710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSEC
IKIQPTDIQPDIFSYLLHIMYTGKGPKQIVDHSRLEEGIRFLHADYLSHIATEMNQVFSP
ETVQSSNLYGIQISTTQKTVVKQGLEVKEAPSSNSGNRAAVQGDHPQLQLSLAIGLDDGT
ADQQRAHPVTQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTSTENSIKIHLC
HYCGERFDSRGNLRQHLHTHVSGSLPFGVPASILESNDLGEVHPLNENSKALECHRLSSF
IVKENEQQPDHTNRDTTEPLQISQVSLISKDAEPVELNCNFSFSRKRKMSCTICGHKFPR
KSQLLEHMYTHKGKSYRYNRFQRFGNALAQRFQPYCDNWSDVSLKSSRLSQEHLDLPCAL
ESELTQENVDAILVE
Download sequence
Identical sequences H9YV53
NP_001181138.1.72884 XP_014999323.1.72884 9544.ENSMMUP00000006314 ENSMMUP00000006314 ENSMMUP00000006314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]