SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006425 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006425
Domain Number 1 Region: 11-159
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 3.4e-51
Family Troponin I 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006425   Gene: ENSMMUG00000004838   Transcript: ENSMMUT00000006832
Sequence length 180
Comment pep:known chromosome:MMUL_1:14:1750312:1751503:1 gene:ENSMMUG00000004838 transcript:ENSMMUT00000006832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALQKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLSEHCPPLHIPGSMSEVQ
ELCKQLHAKIDAAEEEKYDMEVKVQKSSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAM
LKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
Download sequence
Identical sequences G7NBL4 G7PNW3
ENSMMUP00000006425 9544.ENSMMUP00000006425 ENSMMUP00000006425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]