SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006469 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006469
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Globin-like 9.76e-41
Family Globins 0.00000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006469   Gene: ENSMMUG00000004867   Transcript: ENSMMUT00000006877
Sequence length 176
Comment pep:known chromosome:MMUL_1:14:68167158:68176166:1 gene:ENSMMUG00000004867 transcript:ENSMMUT00000006877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKTVVSALWGKVNVDAVGGEALGRLLVVHPWTQRFFESFGDLSSPAAMGNPKV
KAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPGNFRLLGNVLVCMLAHNFDK
EFILQVQAIRRWWLVWLMPWLTTPGQRAGVCAGPSLWQRIHPASAGCLSESGGWCG
Download sequence
Identical sequences ENSMMUP00000006469 ENSMMUP00000006469 9544.ENSMMUP00000006469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]