SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006488 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006488
Domain Number 1 Region: 41-138
Classification Level Classification E-value
Superfamily SH2 domain 4.15e-29
Family SH2 domain 0.00000449
Further Details:      
 
Domain Number 2 Region: 268-329
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-22
Family SH3-domain 0.0000346
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000109
Family SH3-domain 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006488
Domain Number - Region: 190-224
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006488   Gene: ENSMMUG00000004880   Transcript: ENSMMUT00000006896
Sequence length 330
Comment pep:known chromosome:MMUL_1:10:83831865:83902212:1 gene:ENSMMUG00000004880 transcript:ENSMMUT00000006896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPEWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPALPLQQHQHQLQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTSLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Download sequence
Identical sequences A0A2K5HN50 A0A2K5LKD1 A0A2K5ZIR4 A0A2K6E3V3 F7AN37 G7PFL4
ENSPANP00000013378 ENSMMUP00000006488 NP_001248639.1.72884 XP_005567273.1.63531 XP_005567274.1.63531 XP_005567275.1.63531 XP_011710590.1.29376 XP_011710591.1.29376 XP_011710592.1.29376 XP_011710593.1.29376 XP_011710594.1.29376 XP_011710595.1.29376 XP_011819567.1.43180 XP_011819568.1.43180 XP_011819569.1.43180 XP_011834202.1.47321 XP_011834203.1.47321 XP_011834204.1.47321 XP_011887125.1.92194 XP_011887132.1.92194 XP_015005818.1.72884 XP_015005820.1.72884 XP_015005821.1.72884 XP_015005822.1.72884 XP_015312655.1.63531 XP_015312656.1.63531 XP_015312657.1.63531 XP_015312658.1.63531 XP_015312659.1.63531 9544.ENSMMUP00000006488 ENSMMUP00000006488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]