SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006491 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006491
Domain Number 1 Region: 156-219
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 57-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000444
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 27-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000268
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006491   Gene: ENSMMUG00000004882   Transcript: ENSMMUT00000006899
Sequence length 397
Comment pep:known chromosome:MMUL_1:15:2099285:2108427:1 gene:ENSMMUG00000004882 transcript:ENSMMUT00000006899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLETGLERDRERPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSD
CHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVV
CKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKS
DKDSVQEGQDSDAEVSFPDEPSLAEMGPATGLYGSLGEPTPALGRPSGALGNFALEHGGL
AGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPDGPPPMRV
LAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
Download sequence
Identical sequences ENSMMUP00000006491 XP_001096075.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]