SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006492 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006492
Domain Number 1 Region: 159-222
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 68-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000751
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006492
Domain Number - Region: 31-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00127
Family LIM domain 0.022
Further Details:      
 
Domain Number - Region: 119-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0826
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006492   Gene: ENSMMUG00000004882   Transcript: ENSMMUT00000006900
Sequence length 397
Comment pep:known chromosome:MMUL_1:15:2101348:2107392:1 gene:ENSMMUG00000004882 transcript:ENSMMUT00000006900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARGELGPARESAGGDLLLALLARRADLRREIPLCAGCDQHILDRFILKATATGTASAS
NAATATPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFA
CVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYN
TSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGG
SKSDKDSVQEGQDSDAEVSFPEGLLWRKWARPPASTGAWGHTGLGPALGSPGQLRTRAWR
PGRPRAVPRAASRQPLWCPPVPRRPAEPPWPPLLSSLVYPDTSLGLVPSGAPDGPPPMRV
LAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
Download sequence
Identical sequences ENSMMUP00000006492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]