SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006506 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006506
Domain Number 1 Region: 54-181,212-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Domain Number 2 Region: 619-693
Classification Level Classification E-value
Superfamily EF-hand 1.31e-17
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000981
Family D-aminoacid oxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006506   Gene: ENSMMUG00000004897   Transcript: ENSMMUT00000006917
Sequence length 727
Comment pep:known chromosome:MMUL_1:12:20084376:20192123:1 gene:ENSMMUG00000004897 transcript:ENSMMUT00000006917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADYISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTPHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKTHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDHKKQEQLETAKKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADKKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
Download sequence
Identical sequences A0A1D5RJ98 A0A2K5UX04 A0A2K6E1X8
NP_001247984.1.72884 XP_005573269.1.63531 XP_005573270.1.63531 XP_005573271.1.63531 XP_005573272.1.63531 XP_011759045.1.29376 XP_011759046.1.29376 XP_011759047.1.29376 XP_011759048.1.29376 XP_011759049.1.29376 XP_014965621.1.72884 XP_014965622.1.72884 XP_014965623.1.72884 XP_014965624.1.72884 XP_015287704.1.63531 XP_015287705.1.63531 ENSMMUP00000006506 ENSMMUP00000006506 9544.ENSMMUP00000006506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]