SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006514 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006514
Domain Number 1 Region: 151-324,377-570
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.49e-91
Family Phosphonoacetate hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 647-913
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.35e-35
Family DNA/RNA non-specific endonuclease 0.0081
Further Details:      
 
Domain Number 3 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000562
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 105-145
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000301
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006514   Gene: ENSMMUG00000004903   Transcript: ENSMMUT00000006925
Sequence length 915
Comment pep:known chromosome:MMUL_1:8:122048356:122136099:-1 gene:ENSMMUG00000004903 transcript:ENSMMUT00000006925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSSFQSCQIISLFTFAIGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAPECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDSER
PSVYAFYSEQPDFSGHKYGPFGPEESSYGSPFTPAKRPKRKVAPKRRQERPVAPPKKRRR
KIHRMDHYAAETRQDKMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCD
RTEFLSNYLTNVDDITLVPGTLGRIRPKFSNNAKYDPKAIIANLTCKKPDQHFKPYLKQH
LPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVF
VGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFRPTMPEEV
TRPSYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRT
RYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSGIPDHLTSCVRPDVRVSPSFSQNCL
AYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASER
NGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGP
LSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFRKTSRSYPE
ILTLKTYLHTYESEI
Download sequence
Identical sequences A0A2I3NEY5 A0A2K5NMP3 A0A2K5W708 F7CJD6
ENSMMUP00000006514 ENSMMUP00000006514 XP_002805517.1.72884 XP_005564042.1.63531 XP_011717054.1.29376 XP_011912814.1.92194 9544.ENSMMUP00000006514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]