SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006524 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006524
Domain Number 1 Region: 8-51
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000299
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006524   Gene: ENSMMUG00000004914   Transcript: ENSMMUT00000006937
Sequence length 161
Comment pep:novel chromosome:MMUL_1:18:44723997:44724803:-1 gene:ENSMMUG00000004914 transcript:ENSMMUT00000006937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HAYQKCYYFYSGPIYPGHGLMFVQNDCQVFRFCKSKCHKNFKKKRNPRKVGTKAFRKAAG
KLTVHNSFEFEKCRNEPITYQQELWNKTIDATKRVEEIKQKCQAKCIMNRLKKNKELQKV
QDIKEVKQNIHLIRAPLAGKGQLEEKMVQQLQGNVDMKMLP
Download sequence
Identical sequences 9544.ENSMMUP00000006524 ENSMMUP00000006524 ENSMMUP00000006524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]