SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006547 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006547
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000113
Family Glutathione peroxidase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006547   Gene: ENSMMUG00000004936   Transcript: ENSMMUT00000006962
Sequence length 212
Comment pep:known_by_projection chromosome:MMUL_1:19:17016357:17024402:-1 gene:ENSMMUG00000004936 transcript:ENSMMUT00000006962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLFSGRILICNNNDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVR
LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDELRRDLGRQFSVERL
PAVVVLKPDGDVLTRDGADEIQRLGTSCFANWQEAAEVLDRNFQLPEDLEDQEPRSLTEC
LRRRKYRVEKAARGGRDPGGGGGEEGGAGGLF
Download sequence
Identical sequences XP_001113624.1.72884 ENSMMUP00000006547 9544.ENSMMUP00000006547 ENSMMUP00000006547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]